PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG012363t1
Common NameTCM_012363
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MYB
Protein Properties Length: 312aa    MW: 35362.2 Da    PI: 6.7851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG012363t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.9e-192168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd ll+++++++G g+W++ a++ g++Rt+k+c++rw++yl
  Thecc1EG012363t1 21 RGPWTLEEDSLLIHYIARHGEGRWNSLAKRAGLRRTGKSCRLRWLNYL 68
                      89********************************************97 PP

2Myb_DNA-binding51.72e-1674117146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T++E+ l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Thecc1EG012363t1  74 RGNLTPQEQFLILDLHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6511672IPR017930Myb domain
SuperFamilySSF466891.54E-3019115IPR009057Homeodomain-like
SMARTSM007173.5E-162070IPR001005SANT/Myb domain
PfamPF002496.6E-182168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-232275IPR009057Homeodomain-like
CDDcd001672.46E-122368No hitNo description
PROSITE patternPS0017503645IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
SMARTSM007171.3E-1473121IPR001005SANT/Myb domain
PROSITE profilePS5129419.60973123IPR017930Myb domain
PfamPF002496.1E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2376122IPR009057Homeodomain-like
CDDcd001676.61E-1178117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSSLRKSSTS SSEDDAEQLR RGPWTLEEDS LLIHYIARHG EGRWNSLAKR AGLRRTGKSC  60
RLRWLNYLKP DVKRGNLTPQ EQFLILDLHS KWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KQARHLKVDA NSTAFQNVIR CYWIPRLLQK MEGSSSFSSM ASENSTVPQS LDQASQHQAL  180
MTLQQVPGQG PGNLSEAVQN LDHQEQNSDS EHCASSCVSS SESMNNISQI SQFAEYQTSP  240
FRIIGNNDYN NTLAKDCYYD MEAINLASTS APGDFANPVG DCHMPENNWF SNGFADDLWS  300
MGELWELRNL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251812324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036545.10.0Myb domain protein 62, putative
TrEMBLA0A061FUW50.0A0A061FUW5_THECC; Myb domain protein 62, putative
STRINGVIT_17s0000g03560.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2236045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.14e-77myb domain protein 62
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]